Loading...
Statistics

Amarylo, bijoux fantaisie et accessoires de mode - Amarylo
www.amarylo.com/
Amarylo vous propose des bijoux fantaisie : colliers, bracelets, bagues, boucles d'oreilles... et des accessoires de mode : sacs, foulards, pochettes...
Advertisement

Amarylo.com

Home Conversion Technology Metas Server
Amarylo.com is hosted in France . Amarylo.com doesn't use HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Google Font API, Html, Number of used javascripts: 24. First javascripts: Jquery-1.11.0.min.js, Jquery-migrate-1.2.1.min.js, Jquery.easing.js, Number of used analytics tools: 0. Number of used plugins, modules: 19. Its server type is: nginx. Its CMS is: Prestashop.

Technologies in use by Amarylo.com

Technology

Number of occurences: 5
  • CSS
  • Google Font API
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 24
  • jquery-1.11.0.min.js
  • jquery-migrate-1.2.1.min.js
  • jquery.easing.js
  • tools.js
  • global.js
  • 10-bootstrap.min.js
  • 15-jquery.total-storage.min.js
  • 15-jquery.uniform-modified.js
  • products-comparison.js
  • blockfacebook.js
  • treeManagement.js
  • jquery.autocomplete.js
  • blocksearch.js
  • ajax-wishlist.js
  • scrolltop.js
  • jquery.carouFredSel-6.2.1-packed.js
  • cookieslaw.js
  • hoverIntent.js
  • superfish-modified.js
  • blocktopmenu.js
  • blocknewsletter.js
  • homeslider.js
  • jquery.bxslider.js
  • index.js

Content Management System

Number of occurences: 1
  • Prestashop

Server Type

  • nginx

Powered by

  • PHP/5.4.45

CDN

Number of occurences: 2
  • Maxcdn
  • OSS CDN

Used plugins, modules

Number of plugins and modules: 19
  • blockfacebook
  • blocksearch
  • blockwishlist
  • scrolltop
  • mancarousel
  • cookieslaw
  • blocktopmenu
  • blocknewsletter
  • homeslider
  • blockbanner
  • blockcategories
  • blocklanguages
  • blockcontact
  • blockviewed
  • paypal
  • themeconfigurator
  • blockuserinfo
  • smartblog
  • blockreinsurance

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amarylo.com

Missing HTTPS protocol.

    Meta - Amarylo.com

    Number of occurences: 7
    • Name:
      Content:
    • Name: description
      Content: Amarylo vous propose des bijoux fantaisie : colliers, bracelets, bagues, boucles d'oreilles... et des accessoires de mode : sacs, foulards, pochettes...
    • Name: keywords
      Content: bijoux fantaisie,foulards, chèches
    • Name: generator
      Content: PrestaShop
    • Name: robots
      Content: index,follow
    • Name: viewport
      Content: width=device-width, minimum-scale=0.25, maximum-scale=1.6, initial-scale=1.0
    • Name: apple-mobile-web-app-capable
      Content: yes

    Server / Hosting

    • IP: 195.144.11.124
    • Latitude: 48.86
    • Longitude: 2.35
    • Country: France

    Rname

    • ns.phpnet.org
    • ns2.phpnet.org
    • mxsecondaire.phpnet.org
    • mx3.phpnet.org

    Target

    • webmaster.phpnet.org

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx Date: Sat, 16 Apr 2016 12:45:27 GMT Content-Type: text/html; charset=utf-8 Connection: keep-alive X-Powered-By: PHP/5.4.45 P3P: CP="IDC DSP COR CURa ADMa OUR IND PHY ONL COM STA" Set-Cookie: PrestaShop-8ba7c6ab68931bb8a2691b37d1e86761=noSFl8ynPGSVt30CyWzOfn27oaEfU9x4XKqkrmub5ARyU65HV73bOd35VrDvYZ9XVlsSSjZGKPgocXTln20lwTCI0u%2Fj4t8f9gpP%2FuGg4dbmWOYxEykkXC9BKbJ5Ml5cN3n4%2BOUndjz759HOuWMxJezmb%2F3a5tBtrrpiu4gzRKqUKLiGtDPrWn6clwWe9nL9000136; expires=Fri, 06-May-2016 12:45:25 GMT; path=/; domain=amarylo.com; httponly Vary: Accept-Encoding

    DNS

    host: amarylo.com
    1. class: IN
    2. ttl: 3597
    3. type: A
    4. ip: 195.144.11.124
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns.phpnet.org
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns2.phpnet.org
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns.phpnet.org
    5. rname: webmaster.phpnet.org
    6. serial: 2016041614
    7. refresh: 21600
    8. retry: 3600
    9. expire: 1209600
    10. minimum-ttl: 86400
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 20
    5. target: mxsecondaire.phpnet.org
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 100
    5. target: mx3.phpnet.org
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx3.phpnet.org
    host: amarylo.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: v=spf1 ptr ip4:195.144.11.0/24 ip4:91.207.254.0/23 ip4:194.110.192.0/24 ip4:46.255.160.0/21 ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.marylo.com, www.aomarylo.com, www.omarylo.com, www.apmarylo.com, www.pmarylo.com, www.a9marylo.com, www.9marylo.com, www.amarylo.com, www.marylo.com, www.aimarylo.com, www.imarylo.com, www.aumarylo.com, www.umarylo.com, www.aarylo.com, www.amparylo.com, www.aparylo.com, www.amoarylo.com, www.aoarylo.com, www.amiarylo.com, www.aiarylo.com, www.amkarylo.com, www.akarylo.com, www.am.arylo.com, www.a.arylo.com, www.amuarylo.com, www.auarylo.com, www.amjarylo.com, www.ajarylo.com, www.amnarylo.com, www.anarylo.com, www.am-arylo.com, www.a-arylo.com, www.amrylo.com, www.amaorylo.com, www.amorylo.com, www.amaprylo.com, www.amprylo.com, www.ama9rylo.com, www.am9rylo.com, www.amarylo.com, www.amrylo.com, www.amairylo.com, www.amirylo.com, www.amaurylo.com, www.amurylo.com, www.amaylo.com, www.amariylo.com, www.amaiylo.com, www.amaroylo.com, www.amaoylo.com, www.amarlylo.com, www.amalylo.com, www.amarlylo.com, www.amalylo.com, www.amar.ylo.com, www.ama.ylo.com, www.amarlo.com, www.amaryzlo.com, www.amarzlo.com, www.amaryalo.com, www.amaralo.com, www.amaryslo.com, www.amarslo.com, www.amarydlo.com, www.amardlo.com, www.amarylo.com, www.amarlo.com, www.amaryclo.com, www.amarclo.com, www.amary lo.com, www.amar lo.com, www.amaryo.com, www.amaryluo.com, www.amaryuo.com, www.amaryl8o.com, www.amary8o.com, www.amaryl9o.com, www.amary9o.com, www.amaryljo.com, www.amaryjo.com, www.amaryl0o.com, www.amary0o.com, www.amarylmo.com, www.amarymo.com, www.amarylpo.com, www.amarypo.com, www.amaryloo.com, www.amaryoo.com, www.amaryl.com, www.amarylob.com, www.amarylb.com, www.amaryloh.com, www.amarylh.com, www.amarylog.com, www.amarylg.com, www.amaryloj.com, www.amarylj.com, www.amarylom.com, www.amarylm.com, www.amarylo .com, www.amaryl .com, www.amarylov.com, www.amarylv.com,

    Other Reviews

    1. rabbitnotes.com - Diese Website steht zum Verkauf! - Informationen zum Thema Study.
      Diese Website steht zum Verkauf! rabbitnotes.com ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf rabbitnotes.com alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.119
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    2. Order Online | Chinese Food Delivery, Medina OH | Asian Grill
      Award winning Chinese Food in Medina Ohio. Free food Points. Order directly from us for delivery, carryout/pickup and catering. Order Online NOW!
      Denver (United States) - 108.174.150.155
      Server software: Apache
      Technology: AJAX Libraries API, CSS, Html, Javascript, jQuery, jQuery Fancybox, Facebook Box, Google +1 Button, Twitter Button
      Number of Javascript: 6
      Number of meta tags: 4
    3. oneenergydrink.com
      Burlington (United States) - 66.96.147.168
      Server software: Apache/2
      Technology: Html, Html5
      Number of meta tags: 1
    4. Site Update
      Sydney (Australia) - 122.252.1.208
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    5. theater-logistiek.nl
      Netherlands - 31.186.174.13
      Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    6. pennsylvaniacriminaldefenseattorney.com
      Los Angeles (United States) - 208.73.210.214
      Server software: Apache
      Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    7. deepfriedfrost1
      Latham (United States) - 173.198.253.196
      Server software: Microsoft-IIS/7.5
      Technology: Swf Object
    8. mana-organics.co.in
      Provo (United States) - 198.57.247.195
      Server software: nginx/1.10.0
      Technology: Html
      Number of meta tags: 2
    9. Home
      De Juiste Hulp, uw schilder voor binnen en buiten, in Assen en wijde omgeving. Vraag gratis en vrijblijvend een offerte aan.
      Netherlands - 5.157.86.13
      Server software: nginx/1.8.0
      Technology: CSS, Font Awesome, Html, Html5, Javascript
      Number of Javascript: 5
      Number of meta tags: 3
    10. Meine Homepage
      Germany - 217.160.231.103
      Server software: Apache
      Technology: Html
      Number of meta tags: 3